PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family G2-like
Protein Properties Length: 402aa    MW: 44338.5 Da    PI: 6.1337
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890038.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32265320156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  XP_015890038.1 265 KQRRCWSPELHRRFIDALQQLGGSQAATPKQIRELMQVEGLTNDEVKSHLQKYRLH 320
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.554262322IPR017930Myb domain
SuperFamilySSF466897.17E-18263323IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-29264323IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-27265320IPR006447Myb domain, plants
PfamPF002493.8E-8267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MELSLDSSSV FIPTTISEFI SEISTIRDIS EKLSKLDDFV KRLEDEMKKV DAFKRELPLC  60
ILLLNEAIER LKEEATQCKE LKNGPVVEEF IPLKGNSNEN GRADSGDDFS DKRNWMSSAQ  120
LWSTNIDSDY KKRECSVSEL KLRNEEDDRS VPENPIELSC NYGNRGGAFV PFKGKSSCGG  180
LPRSGLKEDK EVSQVPSLSL MPPVAAELCG SLNSKSNSNS KTSHGCRDGG GSGSSLLTDQ  240
MKIPSKTQHQ TAQQQQQQQQ QAFRKQRRCW SPELHRRFID ALQQLGGSQA ATPKQIRELM  300
QVEGLTNDEV KSHLQKYRLH VRKLPPSSAA QGGNLWMAHE QSPDNSKANI SQSGSPQGPL  360
GAAGSAKGLS SNGCDSMEAE EDEKSDGHSW KCGLHKAEQD VL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890038.10.0PREDICTED: uncharacterized protein LOC107424698
TrEMBLM5WFN31e-159M5WFN3_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-61G2-like family protein